FCRL1 (Fc Receptor-like Protein 1, FcR-like Protein 1, FcRL1, Fc Receptor Homolog 1, FcRH1, IFGP Family Protein 1, hIFGP1, Immune Receptor Translocation-associated Protein 5, CD307a, FCRH1, IFGP1, IRTA5, DKFZp667O1421)
Produktgrößen
100ul
£744,00
137949-100UL
Über dieses Produkt
- SKU:
- 137949
- Anwendung:
- Flow Cytometry, Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- FCRL1 may function as an activating coreceptor in B cells and it may function in B cells activation and differentiation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- N-terminus of FCRL1 corresponding to MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human FCRL1.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody