CLIC1 (Chloride Intracellular Channel Protein 1, Chloride Channel ABP, Nuclear Chloride Ion Channel 27, NCC27, Regulatory Nuclear Chloride Ion Channel Protein, hRNCC, G6, NCC27)
Produktgrößen
100ul
£744,00
137854-100UL
Über dieses Produkt
- SKU:
- 137854
- Anwendung:
- Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- C-terminus of CLIC1 corresponding to LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes CLIC1. Species Crossreactivity: Human, mouse and rat.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody