Annexin A13 (ANXA13, ISA, ANX13, Annexin XIII, Annexin-13, Intestine-specific Annexin)
Produktgrößen
100ul
£744,00
137537-100UL
Über dieses Produkt
- SKU:
- 137537
- Anwendung:
- Western Blot
- Klonalität:
- Polyclonal
- Weitere Details:
- The ANXA13 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- N-terminus of ANXA13 corresponding to KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes Annexin A13. Species Crossreactivity: Human and canine.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody