ALAS2 (5-aminolevulinate Synthase, Erythroid-specific, Mitochondrial, ALAS-E, 5-aminolevulinic acid Synthase 2, Delta-ALA Synthase 2, Delta-aminolevulinate Synthase 2, ALASE, ASB, FLJ93603, XLDPP, XLSA)
Produktgrößen
100ul
£744,00
137534-100UL
Über dieses Produkt
- SKU:
- 137534
- Anwendung:
- Western Blot, Immunohistochemistry
- Klonalität:
- Polyclonal
- Weitere Details:
- ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ corresponding to ALAS2.
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Reinheit:
- Purified by affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human ALAS2.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody