HLA-DRB4 (HLA Class II Histocompatibility Antigen, DR beta 4 Chain, MHC Class II Antigen DRB4)
Produktgrößen
50ug
£685,00
127931-50UG
Über dieses Produkt
- SKU:
- 127931
- Anwendung:
- Western Blot, Immunohistochemistry
- translate.label.attr.clone:
- 4C8
- Klonalität:
- Monoclonal
- Weitere Details:
- HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28kD and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa30-266 from human HLA-DRB4 with GST tag. MW of the GST tag alone is 26kD.
- Isotyp:
- IgG2b,k
- Physischer Zustand:
- Supplied as a liquid in PBS, pH 7.2.
- Reinheit:
- Purified by Protein A affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human HLA-DRB4.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Monoclonal Antibody