C4B (Complement C4-B, Basic Complement C4, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 3, CO4, CPAMD3) (FITC)
Produktgrößen
100ul
£914,00
124132-FITC-100UL
Über dieses Produkt
- SKU:
- 124132-FITC
- Anwendung:
- Western Blot, FLISA
- translate.label.attr.clone:
- 2E3
- Klonalität:
- Monoclonal
- Weitere Details:
- C4 plays a central role in the activation of the classical pathway of the complement system. It is processed by activated C1 which removes from the alpha chain the C4a anaphylatoxin. The remaining alpha chain fragment C4b is the major activation product and is an essential subunit of the C3 convertase (C4b2a) and the C5 convertase (C3bC4b2a) enzymes of the classical complement pathway. Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1347-1446 from human C4B with GST tag. MW of the GST tag alone is 26kD.
- Isotyp:
- IgG2b,k
- Physischer Zustand:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Reinheit:
- Purified by Protein A affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human C4B.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Monoclonal Antibody