ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1)
Produktgrößen
100ug
£685,00
123699-100UG
Über dieses Produkt
- SKU:
- 123699
- Anwendung:
- Western Blot
- translate.label.attr.clone:
- 3E2
- Klonalität:
- Monoclonal
- Weitere Details:
- Calcium-transporting ATPase belongs to the cation transport ATPase (P-type) family and plays a critical role in intracellular calcium homeostasis. Mammalian Calcium-transporting ATPases are encoded by at least four separate genes with multiple isoforms produced by alternative splicing. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-97 from human ATP2B1 with GST tag. MW of the GST tag alone is 26kD.
- Isotyp:
- IgG2a,k
- Physischer Zustand:
- Supplied as a liquid in PBS, pH 7.4.
- Reinheit:
- Purified by Protein A affinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes human ATP2B1.
- Quelle:
- human
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Monoclonal Antibody