Adiponutrin 3 (ADPN3, PNPLA3)
Produktgrößen
100ug
£557,00
046296-100UG
Über dieses Produkt
- SKU:
- 046296
- Anwendung:
- Western Blot, Immunohistochemistry
- Klonalität:
- Polyclonal
- Weitere Details:
- Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Western Blot: 1ug/ml Immunohistochemistry (paraffin): 4ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Goat
- Immunogen:
- Synthetic peptide corresponding to CVRKARSRNIGTLHPFFNINKCIRDGLQESLPD from mouse Adiponutrin 3.
- Isotyp:
- IgG
- Physischer Zustand:
- Supplied as a liquid in PBS, 1mg/ml BSA, 0.09% sodium azide.
- Reinheit:
- Purified by immunoaffinity chromatography.
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Recognizes mouse PNPLA3.
- Quelle:
- mouse
- Lagerbedingungen:
- -20[o]C
- Hersteller:
- United States Biological
- Typ:
- Antibodies:Polyclonal Antibody