Anti-Mesothelin Reference Antibody (amatuximab)
Produktgrößen
100 ug
£385,00
CHA298-100UG
1 mg
£965,00
CHA298-1MG
Über dieses Produkt
- SKU:
- CHA298
- Zusätzliche Namen:
- amatuximab
- Anwendung:
- Cell-based/Functional Assay, Detection/Quantitation, ELISA, FACS, Flow Cytometry
- Buffer:
- 25mM histidine, 8% sucrose, 0.01% Tween80 pH6.2
- Klonalität:
- Recombinant Monoclonal
- Konzentration:
- 1 mg/ml
- Weitere Details:
- Anti-Mesothelin Reference Antibody (amatuximab)(CHA298) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It has a predicted MW of 145.5 kDa.
- Immunogen:
- Mesothelin
- Isotyp:
- IgG1
- Physischer Zustand:
- Lyophilized
- Reinheit:
- >95%
- Reaktivitäten:
- Human
- Sequenz:
- QVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGRGFDYWGSGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Versandbedingungen:
- Blue Ice
- Spezifität:
- Mesothelin
- Lagerbedingungen:
- 2-8[o]C, -70[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Sanyou Biopharmaceuticals
- Typ:
- Antibody: Biosimilar Antibody
- Datenblatt des Herstellers:CHA298