SF-20
Produktgrößen
1000 ug
£9036,00
M10-092-L1000-1000UG
Über dieses Produkt
- SKU:
- M10-092-L1000
- Zusätzliche Namen:
- C19orf10; IL25; IL27; SF20; IL27w; R33729_1; EUROIMAGE1875335
- Weitere Details:
- Mouse SF20 is a bone marrow stroma-derived growth factor. SF20 is expressed in the bone marrow, spleen stroma cells, resting mononuclear cells, resting CD8+ and CD19+ cells and activated CD8+ T cells. SF20 has been shown to bind to the surface of cells expressing the receptor TSA-1 (Thymic shared Ag-1). Among SF20's biological activities is stimulation of the proliferation of FDCP2 cells (a mouse factor-dependent hemopoietic cell line) and mouse lymphoid cells.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 15.8 kDa
- Reinheit:
- > 98% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Mouse
- Sequenz:
- MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins