TPO
Produktgrößen
1000 ug
£7439,00
M10-087-L1000-1000UG
Über dieses Produkt
- SKU:
- M10-087-L1000
- Zusätzliche Namen:
- TPO, Thrombopoietin, MGDF, Megakaryocyte colony-stimulating factor, c-MPL Ligand
- Weitere Details:
- TPO is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor and acts as an important regulator of circulating platelets. Human and murine TPO exhibits cross-species reactivity. Recombinant murine TPO is a fully biologically active 174 amino acid polypeptide (18.7 kDa), which contains the erythropoietin-like domain of the full length TPO protein.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 18.7 kDa
- Reinheit:
- > 98% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Human, Mouse
- Sequenz:
- SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins