I-TAC (CXCL11)
Produktgrößen
500 ug
£3118,00
M10-086-L500-500UG
Über dieses Produkt
- SKU:
- M10-086-L500
- Zusätzliche Namen:
- CXCL11
- Weitere Details:
- I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 9.0 kDa
- Reinheit:
- > 98% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Bacteria, Human, Mouse, Non-human Primate
- Sequenz:
- FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins