IP-10 (CXCL10)
Produktgrößen
250 ug
£1821,00
M10-025-L250-250UG
Über dieses Produkt
- SKU:
- M10-025-L250
- Zusätzliche Namen:
- Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
- Weitere Details:
- Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 8.7 kDa
- Reinheit:
- > 98% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Human, Mouse, Non-human Primate, Rat
- Sequenz:
- IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins