Synuclein alpha
Produktgrößen
1000 ug
£1343,00
500-094-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-094-L1000
- Zusätzliche Namen:
- Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor (NACP
- Weitere Details:
- Alpha-Synuclein is a member of the Synuclein family. It is expressed principally in brain but also expressed in low concentrations in all tissues except liver. Alpha synuclein interacts with UCHL1, Phospholipase D and histones. In addition, alpha synuclein is an important regulatory component of vesicular transport in neuronal cells. It has been suggested that alpha synuclein is related to the pathogenesis of Parkinson's Disease and neurodegenerative disorders. Defects in its action will lead to Dementia Lewy Body (DLB).Human Alpha-Synuclein, is also known as Non-A Beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, SNCA, NACP, PARK1. Recombinant Human alpha-Synuclein is produced by our E.coli expression system and the target gene encoding Met1-Ala140 is expressed, and purified as periplasmic protein by ion-exchange chromatography.
- Molekulargewicht:
- 14.4 kda
- Reinheit:
- >95%
- Sequenz:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins