Prolactin
Produktgrößen
1000 ug
£3791,00
500-085-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-085-L1000
- Zusätzliche Namen:
- Mammotropin, Luterotropic hormone, Lutetropin
- Weitere Details:
- Recombinant ovine prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (see Leibovich et al., Protein Expr Purif. 2001 22:489-96).
- Formulierung:
- lyophilized
- Molekulargewicht:
- 23.0 kDa
- Reinheit:
- > 99% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Sheep
- Sequenz:
- ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins