Prolactin, pegylated
Produktgrößen
10 ug
£301,00
500-084-10UG
50 ug
£674,00
500-084-50UG
Über dieses Produkt
- SKU:
- 500-084
- Zusätzliche Namen:
- Mammotropin, Luterotropic hormone, Lutetropin
- translate.label.attr.clone:
- (#3(4H3))
- Weitere Details:
- Recombinant chicken prolactin, consists of one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids was mono-pegylated and purified by proprietary chromatographic techniques as described by Oclon et al. (in press). Its molecular mass is ~ 39 kDa, however under non-denaturing conditions it behaves as 220 kDa protein due to its increased hydrodynamic volume.
- Formulierung:
- lyophilized
- Host:
- Mouse
- Molekulargewicht:
- 39.0 kDa
- Reinheit:
- > 99% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Avian
- Sequenz:
- ALPICPIGSVNCQVSLGELFDRAVKLSHYIHYLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQAQQIHHEDLLNLVVGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVHSGDAGNEIYSHWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDSNC
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins