Prolactin Receptor, soluble
Produktgrößen
1000 ug
£5450,00
500-082-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-082-L1000
- Zusätzliche Namen:
- Mammotropin, Luterotropic hormone, Lutetropin
- Weitere Details:
- Prolactin is a pituitary hormone involved in the stimulation of milk production, salt and water regulation, growth, development and reproduction. The initial step in its action is the binding to a specific membrane receptor (prolactin receptor) which belongs to the superfamily of class 1 cytokine receptors. Prolactin (PRL) is a hormone involved in a variety of important functions including ion transport and osmoregulation, stimulation of milk, protein synthesis as well as the regulation of numerous reproductive functions. PRL exerts its influence on different cell types through a signal transduction pathway which begins with the binding of the hormone to a transmembrane PRL receptor. PRL receptor, varies in size (short and long forms) with tissue source and species, from ~40 kDa to 100 kDa. The PRL receptor consists of at least three separate domains: an extracellular region with 5 cysteines which contains the prolactin binding site, a single transmembrane domain and a cytoplasmic region, the length of which appears to influence ligand binding and regulate cellular function. Recombinant rabbit Prolactin Receptor Extra Cellular Domain (rbPRLR-ECD) produced in E.Coli is a non-glycosylated, polypeptide chain containing 206 amino acids and having a molecular mass of 24120 Da was prepared according to Sandowski et al. (1995) Mol. Cell. Endocrinol. 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 24.1 kDa
- Reinheit:
- > 97% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Rat
- Sequenz:
- GKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins