Leptin
Produktgrößen
100 ug
£301,00
500-071-100UG
500 ug
£647,00
500-071-500UG
Über dieses Produkt
- SKU:
- 500-071
- Zusätzliche Namen:
- Lep; ob; obese
- translate.label.attr.clone:
- Rabbit IgG
- Weitere Details:
- The first biologically active recombinant fish leptin was prepared according to the sequence published by Kurokawa et al. (2005)Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al , General and Comparative Endocrinology (2008) 156(1):83-90.
- Formulierung:
- lyophilized
- Host:
- Rat
- Molekulargewicht:
- 15.3 kDa (momnomer)
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Fish
- Sequenz:
- ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVEGSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQEQQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins