Leptin
Produktgrößen
100 ug
£301,00
500-070-100UG
500 ug
£647,00
500-070-500UG
Über dieses Produkt
- SKU:
- 500-070
- Zusätzliche Namen:
- Lep; ob; obese
- translate.label.attr.clone:
- Goat IgG
- Weitere Details:
- Recombinant porcine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant porcine leptin was purified by proprietary chromatographic techniques, see Raver et al. Prot. Express. Purif. 19, 30-40 (2000).
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 16.0 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Porcine
- Sequenz:
- AVPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins