Leptin
Produktgrößen
1000 ug
£2659,00
500-070-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-070-L1000
- Zusätzliche Namen:
- Lep; ob; obese
- Weitere Details:
- Recombinant porcine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant porcine leptin was purified by proprietary chromatographic techniques, see Raver et al. Prot. Express. Purif. 19, 30-40 (2000).
- Formulierung:
- lyophilized
- Molekulargewicht:
- 16.0 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Porcine
- Sequenz:
- AVPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins