Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A)
Produktgrößen
50 ug
£404,71
500-069-50UG
100 ug
£674,12
500-069-100UG
Über dieses Produkt
- SKU:
- 500-069
- Zusätzliche Namen:
- Lep; ob; obese
- Weitere Details:
- Mono-pegylated (with 20 kDa PEG) recombinant super active ovine leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume pegylated recombinant super active ovine leptin antagonist runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. The half-life in circulation of pegylated recombinant super active ovine leptin antagonist after SC injection was over 20 hours. Recombinant super active ovine leptin antagonist was initially mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. The pegylation of recombinant super active ovine leptin antagonist is similar to that described in Elinav et al. Endocrinology 150:3083-91 (2009) for pegylated recombinant super active mouse leptin antagonist
- Formulierung:
- lyophilized
- Host:
- Rabbit
- Molekulargewicht:
- 35.6 kDa
- Reinheit:
- > 95.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Sheep
- Sequenz:
- AVPIRKVQDDTKTLIKTIVTRINLISHTQSVSSKQRVTGAAAAPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins