Leptin
Produktgrößen
1000 ug
£2659,00
500-062-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-062-L1000
- Zusätzliche Namen:
- Lep; ob; obese
- Weitere Details:
- Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, Recombinant ovine leptin was purified by proprietary chromatographic techniques, see Gertler et al. FEBS Lett. 442, 137-140 (1998).
- Formulierung:
- lyophilized
- Molekulargewicht:
- 16.0 kDa
- Reinheit:
- > 95.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Sheep
- Sequenz:
- AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins