Leptin binding protein
Produktgrößen
50 ug
£471,00
500-046-50UG
100 ug
£647,00
500-046-100UG
Über dieses Produkt
- SKU:
- 500-046
- Zusätzliche Namen:
- Lep; ob; obese
- translate.label.attr.clone:
- Goat IgG
- Weitere Details:
- Recombinant human leptin binding domain (hLBD), is one polypeptide chain containing 208 amino acids and an additional Ala at N-terminus acids. It consists of the cytokine binding domain of leptin receptor (amino acids 428-635 of human leptin receptor and having a molecular mass of ~ 24.5 kDa, It was purified by proprietary chromatographic techniques (see Sandowski et al. J. Biol. Chem. (2002) 277(48):46304-9.
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 24.5 kda
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Human
- Sequenz:
- AIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIHPISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPVPDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMD
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins