IGF-1
Produktgrößen
10 ug
£278,00
500-024-10UG
50 ug
£301,00
500-024-50UG
Über dieses Produkt
- SKU:
- 500-024
- Zusätzliche Namen:
- Igf1; Igf-1; Igf-I; C730016P09Rik
- Weitere Details:
- IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rabbit IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7639 Dalton.
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 7.6 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reaktivitäten:
- Rabbit
- Sequenz:
- MTGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKAA
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins