Growth Hormone
Produktgrößen
1000 ug
£3089,00
500-017-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-017-L1000
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- Recombinant rat GH-22K produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 22367 Dalton.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 22.3 kda
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequenz:
- AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins