Growth Hormone Receptor (hGH binding protein), soluble
Produktgrößen
100 ug
£647,00
500-014-100UG
50 ug
£674,00
500-014-50UG
Über dieses Produkt
- SKU:
- 500-014
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- Recombinant oGHBP, one polypeptide chain containing 244 amino acids and having a molecular mass of ~ 28 kDa, hGHBP was purified by proprietary chromatographic techniques, (see Herman et al. J Biol Chem. (1999) 274, 7631-9.
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 28.0 kDa
- Reinheit:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequenz:
- AFSGSEATPAFFVRASQSLQILYPGLETNSSGNLKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLLVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQF
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins