Growth Hormone
Produktgrößen
10 ug
£277,65
500-012-10UG
50 ug
£404,71
500-012-50UG
Über dieses Produkt
- SKU:
- 500-012
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- IL-1 receptor type II (IL1R-II) is a 65 kD member of the immunoglobulin superfamily also known as IL-1 receptor (IL1R) type II. The IL1R family is composed of three proteins: IL1R type I, IL1-RII, and the widely expressed IL-1RAcP.
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 21.8 kDA
- Reinheit:
- > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Sequenz:
- AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins