Growth Hormone
Produktgrößen
1000 ug
£2659,00
500-012-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-012-L1000
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- Recombinant ovine growth hormone, one polypeptide chain containing 191 amino acids and having a molecular mass of ~ 21.8 kDa.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 21.8 kDA
- Reinheit:
- > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Sequenz:
- AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins