Growth Hormone
Produktgrößen
1000 ug
£1050,00
500-009-L1000-1000UG
Über dieses Produkt
- SKU:
- 500-009-L1000
- Zusätzliche Namen:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Weitere Details:
- Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 21.8 kDa
- Reinheit:
- > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Reaktivitäten:
- Bovine
- Sequenz:
- AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins