FGF-21
Produktgrößen
2 ug
£286,00
500-003-2UG
10 ug
£402,00
500-003-10UG
Über dieses Produkt
- SKU:
- 500-003
- Zusätzliche Namen:
- Fibroblast Growth Factor-21, FGFL
- Weitere Details:
- Bovine FGF-21 is a secreted growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. Recombinant bovine FGF-21 is a 19.5 kDa protein containing 182 amino acid residues.
- Formulierung:
- lyophilized
- Host:
- E. coli
- Molekulargewicht:
- 19.5 kDa
- Reinheit:
- > 98% by SDS-PAGE & gel filtration
- Reaktivitäten:
- Bovine
- Sequenz:
- AHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAHLEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGKLYGSLHFDPKACSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPAAPPDPPGILAPEPPDVGSSDPLSMVGPSYGRSPSYTS
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins