FABP5
Produktgrößen
5 ug
£147,00
400-024-5UG
25 ug
£307,00
400-024-25UG
Über dieses Produkt
- SKU:
- 400-024
- Zusätzliche Namen:
- Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP
- Buffer:
- PBS
- translate.label.attr.clone:
- Rabbit IgG
- Weitere Details:
- Human FABP5, also known as epidermal fatty acid binding protein (E-FABP), is a 15 kDa member of a cytosolic fatty acid binding protein superfamily. It is associated with keratinocytes and adipocytes and is suggested to promote fatty acid availability to enzymes, protect cell structures from fatty acid attack, and target fatty acids to nuclear transcription factors. The amino acid sequence of human FABP5 is 80%, 81% and 92% identical to that of mouse, rat and bovine FABP5, respectively.
- Formulierung:
- lyophilized
- Host:
- Mouse
- Molekulargewicht:
- 16.1 kDa
- Reinheit:
- > 98% by SDS-PAGE & visualized by Coomassie stain
- Reaktivitäten:
- Human
- Sequenz:
- MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVETRHHHHHH
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins