VEGF-B167
Produktgrößen
5 ug
£147,00
300-080-5UG
20 ug
£271,00
300-080-20UG
Über dieses Produkt
- SKU:
- 300-080
- Zusätzliche Namen:
- vascular endothelial growth factor B; VEGFB; VRF; VEGFL
- Buffer:
- 50mM acetic acid
- Weitere Details:
- VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a "cysteine knot" like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 38 kDa
- Reinheit:
- > 98% by SDS-PAGE & Coomassie stain
- Reaktivitäten:
- Human
- Sequenz:
- MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDTCRCRKLRR
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins