IL-4
Produktgrößen
50 ug
£443,00
200-023-DC-50UG
Über dieses Produkt
- SKU:
- 200-023-DC
- Zusätzliche Namen:
- IL4; BSF1; IL-4; BCGF1; BSF-1; BCGF-1
- Buffer:
- PBS
- translate.label.attr.clone:
- (#8D29)
- Weitere Details:
- IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 14.9 kDa globular protein containing 130 amino acid residues
- Formulierung:
- lyophilized
- Host:
- Mouse
- Molekulargewicht:
- 14.9 kDa
- Reinheit:
- >98%
- Reaktivitäten:
- Human
- Sequenz:
- MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins