PTHrP
Produktgrößen
10 ug
£178,82
100-275-10UG
50 ug
£307,06
100-275-50UG
Über dieses Produkt
- SKU:
- 100-275
- Zusätzliche Namen:
- Parathyroid Hormone-related Protein
- translate.label.attr.clone:
- Rabbit IgG
- Weitere Details:
- PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.
- Formulierung:
- lyophilized
- Host:
- Rabbit
- Molekulargewicht:
- 9.8 kDa
- Reinheit:
- > 98% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Human
- Sequenz:
- AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins