PTHrP
Produktgrößen
250 ug
£915,00
100-275-L250-250UG
Über dieses Produkt
- SKU:
- 100-275-L250
- Zusätzliche Namen:
- Parathyroid Hormone-related Protein
- Weitere Details:
- PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 9.8 kDa
- Reinheit:
- > 98% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Human
- Sequenz:
- AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins