I-TAC (CXCL11) (Animal Free)
Produktgrößen
50 ug
£719,00
100-058-L50-AF-50UG
Über dieses Produkt
- SKU:
- 100-058-L50-AF
- Zusätzliche Namen:
- CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
- Weitere Details:
- I-TAC is a 'non-ELR' CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, ormonocytes. Recombinant Human I-TAC (CXCL11) is an 8.3 kDa protein containing 73 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 8.3 kDa
- Reinheit:
- ≥98%
- Reaktivitäten:
- Hamster, Human, Mouse, Non-human Primate, Rabbit
- Sequenz:
- FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins