IP-10 (CXCL10)
Produktgrößen
1000 ug
£5192,00
100-057-L1000-1000UG
Über dieses Produkt
- SKU:
- 100-057-L1000
- Zusätzliche Namen:
- CXCL10
- Weitere Details:
- IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
- Formulierung:
- lyophilized
- Molekulargewicht:
- 8.6 kDa
- Reinheit:
- > 98% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Human, Mouse, Non-human Primate, Other Species
- Sequenz:
- VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Versandbedingungen:
- Blue Ice
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins