4-1BBL
Produktgrößen
5 ug
£179,00
100-001-5UG
20 ug
£307,00
100-001-20UG
Über dieses Produkt
- SKU:
- 100-001
- Zusätzliche Namen:
- TNFSF9; CD137L; 4-1BB-L
- translate.label.attr.clone:
- (#9E29)
- Weitere Details:
- 4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain. The soluble form of 4-1BBL contains the TNF-like portion of the extracellular domain of 4-1BBL. Recombinant human 4-1BBL is a soluble 19.5 kDa protein consisting of 185 amino acid residues.
- Formulierung:
- lyophilized
- Host:
- Mouse
- Molekulargewicht:
- 19.5 kDa
- Reinheit:
- > 97% by SDS-PAGE & HPLC analyses
- Reaktivitäten:
- Human
- Sequenz:
- MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- Room Temperature
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins