ALOX12 / 12 Lipoxygenase Antibody
Produktgrößen
100 ug
£ POA
LS-C782971-100UG
Über dieses Produkt
- SKU:
- LS-C782971
- Zusätzliche Namen:
- ALOX12, 12S-lipoxygenase, 12-lipoxygenase, 12S-LOX, 12(S)-lipoxygenase, 12-LOX, 12 Lipoxygenase, Arachidonate 12-lipoxygenase, LOG12, Platelet 12-LOX, Platelet-type 12-lipoxygenase, Platelet-type lipoxygenase 12
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) from the human protein were used as the immunogen for the 12 Lipoxygenase antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:809503