ANGPTL4 Antibody
Produktgrößen
100 ug
£ POA
LS-C782817-100UG
Über dieses Produkt
- SKU:
- LS-C782817
- Zusätzliche Namen:
- ANGPTL4, Angiopoietin-like 4, Angiopoietin-related protein 4, Angiopoietin-like protein 4, Fasting-induced adipose factor, NL2, PGAR, Pp1158, ARP4, FIAF, HFARP
- Anwendung:
- ELISA, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 369-406 (QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS) from the human protein were used as the immunogen for the ANGPTL4 antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:809347