ANXA8 / Annexin A8 Antibody
Produktgrößen
100 ug
£ POA
LS-C782781-100UG
Über dieses Produkt
- SKU:
- LS-C782781
- Zusätzliche Namen:
- ANXA8, Annexin A8, Annexin-8, ANX8, Vascular anticoagulant-beta, Annexin VIII, VAC-beta
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:809311