ANO1 / DOG1 / TMEM16A Antibody
Produktgrößen
100 ug
£ POA
LS-C782191-100UG
Über dieses Produkt
- SKU:
- LS-C782191
- Zusätzliche Namen:
- ANO1, Oral cancer overexpressed 2, Transmembrane protein 16A, ORAOV2, Anoctamin-1, DOG1, TAOS2, TMEM16A
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids QQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDE were used as the immunogen for the TMEM16A antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:808719