ABCB1 / MDR1 / P Glycoprotein Antibody
Produktgrößen
100 ug
£ POA
LS-C782184-100UG
Über dieses Produkt
- SKU:
- LS-C782184
- Zusätzliche Namen:
- ABCB1, ABC20, Abcb1b, CLCS, Colchicin sensitivity, CD243, IBD13, gp170, MDR1, Multidrug resistance protein 1, P glycoprotein, P-glycoprotein 1, P-GP, CD243 antigen, PGY1
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY were used as the immunogen for the P Glycoprotein antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Protein A Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:808712