AP-1 / JUND Antibody
Produktgrößen
100 ug
£ POA
LS-C782139-100UG
Über dieses Produkt
- SKU:
- LS-C782139
- Zusätzliche Namen:
- JUND, Activator protein 1, AP-1, JunD-FL isoform, Jun D proto-oncogene, Transcription factor jun-D
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY from the human protein were used as the immunogen for the JUND antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:808667