AKR1B10 Antibody
Produktgrößen
100 ug
£ POA
LS-C781936-100UG
Über dieses Produkt
- SKU:
- LS-C781936
- Zusätzliche Namen:
- AKR1B10, AKR1B11, Aldose reductase-like peptide, ALDRLn, AKR1B12, Aldose reductase-like, Aldose reductase-like 1, ARP, HARP, HSI, Small intestine reductase, ARL-1, SI reductase
- Anwendung:
- IHC-Paraffin, Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 285-316 (EMATILSFNRNWRACNVLQSSHLEDYPFNAEY) from the human protein were used as the immunogen for the AKR1B10 antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:808464