ACO2 / Aconitase 2 Antibody
Produktgrößen
100 ug
£ POA
LS-C781792-100UG
Über dieses Produkt
- SKU:
- LS-C781792
- Zusätzliche Namen:
- ACO2, ACONM, Aconitase 2, Aconitase 2, mitochondrial, Citrate hydro-lyase, ICRD
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein were used as the immunogen for the Aconitase 2 antibody.
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:808320