AICDA / AID Antibody (Biotin)
Produktgrößen
100 ul
£ POA
LS-C761216-100UL
Über dieses Produkt
- SKU:
- LS-C761216
- Zusätzliche Namen:
- AICDA, AID, ARP2, CDA2, Cytidine aminohydrolase, HIGM2
- Anwendung:
- Immunohistochemistry
- Buffer:
- PBS, 0.09% sodium azide, 2% sucrose
- Klonalität:
- Polyclonal
- Konjugat:
- Biotin
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Canine, Horse, Human, Mouse, Porcine, Rabbit, Rat
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:787067