ATXN1 / SCA1 Antibody (clone S76-8)
Produktgrößen
100 ug
£ POA
LS-C759905-100UG
Über dieses Produkt
- SKU:
- LS-C759905
- Zusätzliche Namen:
- ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1
- Anwendung:
- Immunofluorescence, Western Blot
- Buffer:
- PBS, pH 7.4, 0.1% Sodium Azide, 50% Glycerol
- translate.label.attr.clone:
- S76-8
- Klonalität:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- Synthetic peptide corresponding to aa 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. This sequence is 100% identical to rat and 88% identical to human Ataxin-1.
- Isotyp:
- IgG2b
- Aufreinigung:
- Protein G Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:785756