ACTN3 Antibody
Produktgrößen
100 ug
£ POA
LS-C756661-100UG
Über dieses Produkt
- SKU:
- LS-C756661
- Zusätzliche Namen:
- ACTN3, Actinin, alpha 3, Alpha-actinin skeletal muscle, Alpha-actinin-3, F-actin cross-linking protein
- Anwendung:
- IHC-Paraffin, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ACTN3 (574-617 aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
- Isotyp:
- IgG1
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Spezifität:
- No cross reactivity with other proteins.
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Monoclonal Antibody
- Datenblatt des Herstellers:782345