ANO1 / DOG1 / TMEM16A Antibody
Produktgrößen
100 ug
£ POA
LS-C756420-100UG
Über dieses Produkt
- SKU:
- LS-C756420
- Zusätzliche Namen:
- ANO1, Oral cancer overexpressed 2, Transmembrane protein 16A, ORAOV2, Anoctamin-1, DOG1, TAOS2, TMEM16A
- Anwendung:
- Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Klonalität:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human TMEM16A (QQIHKEK VLMVELFMREEQDKQQLLETWMEKERQKDE).
- Isotyp:
- IgG
- Physischer Zustand:
- Lyophilized
- Aufreinigung:
- Affinity Purified
- Reaktivitäten:
- Human, Mouse, Rat
- Versandbedingungen:
- Ambient
- Spezifität:
- No cross reactivity with other proteins.
- Lagerbedingungen:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- LifeSpan Biosciences
- Typ:
- Antibody: Polyclonal Antibody
- Datenblatt des Herstellers:782104